General Information

  • ID:  hor001574
  • Uniprot ID:  P10552
  • Protein name:  TPAEDFMRF-amide
  • Gene name:  FMRFa
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0002209 behavioral defense response; GO:0006942 regulation of striated muscle contraction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0008344 adult locomotory behavior; GO:0008345 larval locomotory behavior; GO:0010459 negative regulation of heart rate; GO:0045822 negative regulation of heart contraction; GO:1900075 positive regulation of neuromuscular synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  TPAEDFMRF
  • Length:  9(204-212)
  • Propeptide:  MGIALMFLLALYQMQSAIHSEIIDTPNYAGNSLQDADSEVSPSQDNDLVDALLGNDQTERAELEFRHPISVIGIDYSKNAVVLHFQKHGRKPRYKYDPELEAKRRSVQDNFMHFGKRQAEQLPPEGSYAGSDELEGMAKRAAMDRYGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRTPAEDFMRFGRTPAEDFMRFGRSDNFMRFGRSPHEELRSPKQDFMRFGRPDN
  • Signal peptide:  MGIALMFLLALYQMQSAIHSEI
  • Modification:  T9 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have modulatory actions at skeletal neuromuscular junctions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10552-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001574_AF2.pdbhor001574_ESM.pdb

Physical Information

Mass: 125612 Formula: C50H72N12O15S
Absent amino acids: CGHIKLNQSVWY Common amino acids: F
pI: 4.18 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -50 Boman Index: -2290
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 11.11
Instability Index: 3493.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1390001
  • Title:  Isolation and Structural Characterization of Drosophila TDVDHVFLRFamide and FMRFamide-containing Neural Peptides.
  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System